PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000690933
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HB-other
Protein Properties Length: 233aa    MW: 26609.1 Da    PI: 6.8697
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000690933genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox50.24.3e-16871251856
                    HHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox  18 lFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    lF+++++p+ ++r +L++ lgL+ rqVk+WFqNrR+++k
  MDP0000690933  87 LFKECPHPDDKQRMKLSQDLGLKPRQVKFWFQNRRTQMK 125
                    7***********************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003894.4E-770131IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-1587132IPR009057Homeodomain-like
SuperFamilySSF466892.31E-1387128IPR009057Homeodomain-like
PfamPF000461.6E-1387125IPR001356Homeobox domain
PROSITE profilePS5007113.92888127IPR001356Homeobox domain
CDDcd000863.36E-1388128No hitNo description
PROSITE patternPS000270102125IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MAMGGGNVVS SETLFPSPIQ NPNFNFMPAH HQLPFQPLSS ILSPPKEENG VVMMMRGKED  60
QMIERGSGSD QVEEQSGNEQ EADNQLLFKE CPHPDDKQRM KLSQDLGLKP RQVKFWFQNR  120
RTQMKAQQDR SDNVMLRAEN ENLKNENYRP QAALCNIMCP DCGGPAMIGD CWGLKRLHYF  180
GDAYLTKKNN VHGSFFVYGP DQLSWAKTRL HFNRDIGIDE QHLRLENARL KE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008356446.11e-103PREDICTED: homeobox-leucine zipper protein HDG5-like isoform X2
RefseqXP_008356447.11e-103PREDICTED: homeobox-leucine zipper protein ROC3-like isoform X3
SwissprotA2ZAI76e-43ROC3_ORYSI; Homeobox-leucine zipper protein ROC3
TrEMBLM5WW928e-82M5WW92_PRUPE; Uncharacterized protein
STRINGVIT_02s0012g02030.t015e-68(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1882656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.15e-43homeobox-7